Protein Info for B158DRAFT_0015 in Kangiella aquimarina DSM 16071

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 7 to 153 (147 residues), 97.7 bits, see alignment E=2.8e-32 PF04542: Sigma70_r2" amino acids 8 to 71 (64 residues), 42.7 bits, see alignment E=7.9e-15 PF07638: Sigma70_ECF" amino acids 73 to 152 (80 residues), 21.6 bits, see alignment E=3.7e-08 PF08281: Sigma70_r4_2" amino acids 99 to 150 (52 residues), 58.3 bits, see alignment E=9.6e-20 PF04545: Sigma70_r4" amino acids 103 to 152 (50 residues), 45.6 bits, see alignment E=8.3e-16

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 97% identity to kko:Kkor_0400)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>B158DRAFT_0015 RNA polymerase sigma factor, sigma-70 family (Kangiella aquimarina DSM 16071)
MSQELIDYSRKALIFAVQLLGNQSDAEDVVQASVEKALAHPKAPKGGIDLQKWLYRVVRN
AAIDRIRQLSREDELDTEQQSTSSQSPEMQLEQLQIKTRLMQALSALPVMQRELIVLRDY
HGNSYEDIAEILAIPTGTVMSRLHRARMALRELLKHELNEVNHESV