Protein Info for B158DRAFT_0002 in Kangiella aquimarina DSM 16071

Annotation: tyrosyl-tRNA synthetase (EC 6.1.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR00234: tyrosine--tRNA ligase" amino acids 9 to 396 (388 residues), 390 bits, see alignment E=7.1e-121 PF00579: tRNA-synt_1b" amino acids 31 to 313 (283 residues), 294 bits, see alignment E=1.3e-91 PF01479: S4" amino acids 343 to 381 (39 residues), 28.1 bits, see alignment 1.4e-10

Best Hits

Swiss-Prot: 71% identical to SYY_PSEPK: Tyrosine--tRNA ligase (tyrS) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 96% identity to kko:Kkor_0413)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>B158DRAFT_0002 tyrosyl-tRNA synthetase (EC 6.1.1.1) (Kangiella aquimarina DSM 16071)
MTDVQAAFAEIKRGAEEILLEDELLEKLKTGKPLKIKAGFDPTAPDLHLGHTVLINKLRQ
FQQLGHEIIFLIGDFTGMIGDPTGKNATRKPLTREEVLANAETYKEQVFKILDPDKTTIA
FNSEWCEKLGAAGMIKLASHTTVARMLERDDFKKRYGNEQPIAIHEFLYPLVQGYDSVAL
ESDVELGGTDQRFNLLMGRELQKHYGQRPQTVLMMPLLEGLDGVQKMSKSLGNYVGITEA
PGVMYQKLLSIPDSMMWRYFELLSFRPLAEIEELKMQVEQGANPRDIKIELAKEIIERFH
DKEAADNAHNAAGNIIKEGEVPEGTPEVEVDMDGAEQFPIGAIINRAGLAANSAQAKDML
KNGRVKVDWEVVEPSLMLKAGKYLIQAGKKKIAYVTLI