Protein Info for Atu6184 in Agrobacterium fabrum C58

Annotation: virA/G regulated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 668 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 36 (1 residues), see Phobius details amino acids 38 to 51 (14 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details PF02534: T4SS-DNA_transf" amino acids 97 to 537 (441 residues), 514.8 bits, see alignment E=3.5e-158 PF10412: TrwB_AAD_bind" amino acids 165 to 484 (320 residues), 74.9 bits, see alignment E=9e-25 PF12696: TraG-D_C" amino acids 391 to 509 (119 residues), 100.4 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 100% identical to VIRD4_AGRFC: Protein VirD4 (virD4) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03205, type IV secretion system protein VirD4 (inferred from 100% identity to atu:Atu6184)

Predicted SEED Role

"Coupling protein VirD4, ATPase required for T-DNA transfer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P18594 at UniProt or InterPro

Protein Sequence (668 amino acids)

>Atu6184 virA/G regulated protein (Agrobacterium fabrum C58)
MNSSKTTPQRLAVSIVCSLAAGFCAASLYVTFRHGFNGEAMMTFSVFAFWYETPLYMGHA
TPVFYCGLAIVVSTSIVVLLSQLIISFRNHEHHGTARWAGFGEMRHAGYLQRYNRIKGPI
FGKTCGPRWFGSYLTNGEQPHSLVVAPTRAGKGVGVVIPTLLTFKGSVIALDVKGELFEL
TSRARKAGGDAVFKFSPLDPERRTHCYNPVLDIAALPPERQFTETRRLAANLITAKGKGA
EGFIDGARDLFVAGILTCIERGTPTIGAVYDLFAQPGEKYKLFAHLAEESRNKEAQRIFD
NMAGNDTKILTSYTSVLGDGGLNLWADPLVKAATSRSDFSVYDLRRKRTCVYLCVSPNDL
EVVAPLMRLLFQQVVSILQRSLPGKDERHEVLFLLDEFKHLGKLEAIETAITTIAGYKGR
FMFIIQSLSALTGIYDDAGKQNFLSNTGVQVFMATADDETPTYISKAIGDYTFKARSTSY
SQARMFDHNIQISDQGAPLLRPEQVRLLDDNNEIVLIKGHPPLKLRKVRYYSDRMLRRLF
ECQIGALPEPASLMLSEGVHRDGQDLSQQAAVTEAQGLGDIDSIPNNMEAATPQNSEMDD
EQDSLPTGIDVPQGLIESDEVKEDAGGVVPDFGVSAEMAPAMIAQQQLLEQIIALQQRYG
PASSHSVK