Protein Info for Atu6168 in Agrobacterium fabrum C58

Annotation: component of type IV secretion system, pilin subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 60 to 87 (28 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details PF04956: TrbC" amino acids 31 to 117 (87 residues), 64.6 bits, see alignment E=3.9e-22

Best Hits

Swiss-Prot: 100% identical to VIRB2_AGRFC: Protein virB2 (virB2) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03197, type IV secretion system protein VirB2 (inferred from 100% identity to atu:Atu6168)

Predicted SEED Role

"Major pilus subunit of type IV secretion complex, VirB2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P17792 at UniProt or InterPro

Protein Sequence (121 amino acids)

>Atu6168 component of type IV secretion system, pilin subunit (Agrobacterium fabrum C58)
MRCFERYRVHLNRLSLSNAVMRMVSGYAPSVVGAMGWSIFSSGPAAAQSAGGGTDPATMV
NNICTFILGPFGQSLAVLGIVAIGISWMFGRASLGLVAGVVGGIVIMFGASFLGKTLTGG
G