Protein Info for Atu6136 in Agrobacterium fabrum C58

Annotation: Na+/phosphate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 51 to 75 (25 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 109 to 122 (14 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 190 to 233 (44 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 16 to 150 (135 residues), 114.4 bits, see alignment E=4.2e-37 TIGR01013: sodium-dependent inorganic phosphate (Pi) transporter" amino acids 70 to 521 (452 residues), 551.1 bits, see alignment E=1.1e-169 PF01895: PhoU" amino acids 342 to 420 (79 residues), 42.2 bits, see alignment E=8.6e-15 amino acids 446 to 529 (84 residues), 34.7 bits, see alignment E=2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu6136)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z2PJZ8 at UniProt or InterPro

Protein Sequence (550 amino acids)

>Atu6136 Na+/phosphate symporter (Agrobacterium fabrum C58)
MESTIVLINLCGAVALLLFGLAQVKDGASRALGARLRTGLASGTKSSARSFLSGFVATVA
LQSSTATALMVSSFVERELIKPRMAQVVLLGANVGTAVTAWIVATGIEWVSPALLFVGII
LYRGGSTSRQGAGTALLGIALMLLSLHLLSNATEPLRHSPALAAFIGLLENAWPVAMIFS
AAIAFASSSSLAAVVLILSLTSTGILSGGLVVALVLGANFGGAIPPVIASLSASAAARRV
TLGNLIVRAIGCLLILPVADILASWLSMLPVPASKLPVDAHLALNIGLALLAMPFSRLLA
RWMGVLIPASEQADNTPKFLDPDELSTPVVALTSAAREVLGVGDLIERMLLRVSDAFQQN
NAARLKDIAQLERQVDRLQQEVKVYLSKLGRTGLSEDEGRRSIVIIDYAINLEHIGDIVE
KGLLPEVTKKIAHGLKFSDDGFSELTQLFQLTVDNLRIAQTILITRDINLARQLMERKVE
VRHMEKQSSERHLERLRDGRTDSLQTSSLHLDILRDLKRINAHIVSVAHPIMDEQGLLGE
SRLIAGGSAD