Protein Info for Atu6119 in Agrobacterium fabrum C58

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 PF05284: DUF736" amino acids 17 to 114 (98 residues), 111.2 bits, see alignment E=1e-36

Best Hits

Swiss-Prot: 51% identical to Y4EB_SINFN: Uncharacterized protein y4eB (NGR_a03910) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 98% identity to avi:Avi_9175)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D2G5 at UniProt or InterPro

Protein Sequence (118 amino acids)

>Atu6119 conserved hypothetical protein (Agrobacterium fabrum C58)
MGAARANRKRSTTMAVIGEFNTNGNNSIIGNVRTLTVSMKARLNPIERVSRDAPDFRITA
GNGVEVGAGWNKVSNDGEPFISVKLDDPSFNAPITAALWPGEKEGEYALIWNRPKREA