Protein Info for Atu6108 in Agrobacterium fabrum C58

Annotation: alkylphosphonate uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF03831: YjdM" amino acids 34 to 100 (67 residues), 105.1 bits, see alignment E=6.9e-35

Best Hits

Swiss-Prot: 46% identical to YJDM_STRMU: Protein YjdM (yjdM) from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

KEGG orthology group: K06193, phosphonoacetate hydrolase [EC: 3.11.1.2] (inferred from 100% identity to atu:Atu6108)

Predicted SEED Role

"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKV9 at UniProt or InterPro

Protein Sequence (101 amino acids)

>Atu6108 alkylphosphonate uptake protein (Agrobacterium fabrum C58)
MSDHSGDDYVYDEATGEWRPASEISAEKAKAAEVRDASGNVLADGDSVVLIKDLKVKGAG
QTLKQGTVIRSIRLTDEPEEIDCRHDAIKGLVLRTEFVRKR