Protein Info for Atu6076 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (peptide)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 254 to 280 (27 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 14 to 114 (101 residues), 30.5 bits, see alignment E=3.7e-11 PF00528: BPD_transp_1" amino acids 126 to 331 (206 residues), 141.4 bits, see alignment E=2.7e-45

Best Hits

Swiss-Prot: 37% identical to GSIC_PECAS: Glutathione transport system permease protein GsiC (gsiC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu6076)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKX9 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Atu6076 ABC transporter, membrane spanning protein (peptide) (Agrobacterium fabrum C58)
MGGSSMKRLTRVGRSLLRNLIQAVPTMFVIVTLGFFVLQLAPGDAADYMAAESGAATQET
VADIRRAFGLDLPLLDQLANYYTSLAHFSLGISPRYGVPVADLIMERLPGTLTLMVLAIV
IALLVGIAAGTIMALNATRAADRILSVASLLFYSVPTFWIGLIFIIVFSVKLGWLPAGGM
KTIGASSGGFGWLIDRVSYALLPATSLALYYMAIYARLTRSSILEVIGQDHVRTAKAKGL
APRQVVLRHVLRNALIPITTVAGIHVAGILGGAIVIETVFSWPGMGRLAFDAVMAREYTL
LLGIMLVSSVLVICVNAIVDIIQAALDPRIEVR