Protein Info for Atu6069 in Agrobacterium fabrum C58

Annotation: ABC transporter, nucleotide binding/ATPase protein (ribose)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00005: ABC_tran" amino acids 21 to 177 (157 residues), 65.5 bits, see alignment E=8.3e-22 amino acids 287 to 445 (159 residues), 68.6 bits, see alignment E=9.4e-23

Best Hits

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to atu:Atu6069)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z2PLW1 at UniProt or InterPro

Protein Sequence (528 amino acids)

>Atu6069 ABC transporter, nucleotide binding/ATPase protein (ribose) (Agrobacterium fabrum C58)
MRMSILSVESLTHSFGPSPALRDINLAIRSGEVVGIVGENGAGKSTLLNVLSGTLKPSRG
TVAIGGTPVALENYYEANQRGIWRIFQDPALIGALPVYESLFLGHEKRFTRFGVLNKAKM
IDIARDLVRSMGIAVDVKHLMLNYDFATRQSLEVCRAILLPKVLGLPSGFVLFDEPTTGL
SRAEVVRLLESMGRLRRQGAGVAFVSHRLQEVFDVCDRLIVLKDGAIVGEGPISQFDEAG
LHRLMVGRAFESTTPGKRSTLNEEPFLVVKGLSRSSRPSAGQRLTHLTDISFNVGKGEIV
GIGGLLGSGKGQLLRVLAGVTSHRDGTVELGGMPLAGSIAQRKQKGIAFIPGDRSNEAVV
VTADVASNISLPSGHAGARGFSNAFGIWRSAREQNVARQMIVSLRIKAVSGQPLRTLSGG
NQQKVSLARWIHREPVLLLIENPTAGVDVGAKREIYALLRDLTAHGTSILYVTDDLPELI
SLSDRILIMRDGRIVSDIDNRQTLTTEHALVADMIGPASNEKTPIVAP