Protein Info for Atu6059 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (nitrate/sulfonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13379: NMT1_2" amino acids 26 to 252 (227 residues), 66.6 bits, see alignment E=4.6e-22 TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 29 to 318 (290 residues), 199.9 bits, see alignment E=2.6e-63 PF09084: NMT1" amino acids 41 to 252 (212 residues), 79.6 bits, see alignment E=4.9e-26

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to ara:Arad_14204)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z2PLU7 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Atu6059 ABC transporter, substrate binding protein (nitrate/sulfonate) (Agrobacterium fabrum C58)
MLKKNIAKTATALVAAALLWAGSAAAETVNIGFMPFVPYSAILLAKQKGWVDEEFTKAGL
KDVEIKWHQFAGGPPVNEAFASGALDIAALGDTPSLIAFANGIDTRFVGLACKGAKAEAL
IVLKDSSVKTVKDLKGKKVATLRGGNVHELLVLVLAEAGLKISDVEFLNLGLQDMGIALT
KGDVDAVLVWEPLLTKLDSEGVSRTLRDGAGLKSNLNPIVALGSFAAKHPDVLKAYLQAV
KRGAEALRSDPAGSAQVLAPVVGLTPKQTELAFSRFEWKPTVTEADQAELADSVKFLLDN
HFIRQTFEVSSFADQAFFNF