Protein Info for Atu6057 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (nitrate/sulfonates)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 59 to 82 (24 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 135 to 303 (169 residues), 78.6 bits, see alignment E=2.6e-26

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to ara:Arad_14202)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z2PJR1 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Atu6057 ABC transporter, membrane spanning protein (nitrate/sulfonates) (Agrobacterium fabrum C58)
MDDSQRSVHSGAFNSRDAPRLSFPGCQTQRRGSREDGGIVSKQAVSTTIGHSVPSYRPLA
LLSAFAVRVGPLVALVTVWQVACDFGAVRPVLLPAPSTIVRTIWNMTLSGELAEHVAVSS
ARVLQGFGIAAVLALALGIVMGLIGPLNRLADLMVQVLKPIPPIAWIPLSILWFGIGEEA
KIFIIVLGAFFPILVSTLDAVHQTDVRYVELARVLEVPRLNFIRQVMIPGALPQIMSGLR
LGITMSWMCVVAAELIAASSGIGFLIMDGRVMSNASVVLAGMITLGVLGKLTDDALRFAE
RRLVRWRAGFSGL