Protein Info for Atu6040 in Agrobacterium fabrum C58

Annotation: conjugal transfer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 47 to 69 (23 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details PF04956: TrbC" amino acids 5 to 100 (96 residues), 70.6 bits, see alignment E=5.4e-24

Best Hits

Swiss-Prot: 76% identical to TRBC_RHIRD: Conjugal transfer protein TrbC (trbC) from Rhizobium radiobacter

KEGG orthology group: K03197, type IV secretion system protein VirB2 (inferred from 100% identity to atu:Atu6040)

Predicted SEED Role

"Conjugative transfer protein TrbC" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z2PLS5 at UniProt or InterPro

Protein Sequence (133 amino acids)

>Atu6040 conjugal transfer protein (Agrobacterium fabrum C58)
MSHKIRIAIALAAFAAGSFIGLADPAFASSGGSLPWESPLQQIQQSITGPVAGFIALAAV
AIAGGMLIFGGELNDFARRLCYVALVGGVLLGATQIIALFGATGASIGEMEARTGPGIIE
PVMLRAQGEGAHG