Protein Info for Atu6038 in Agrobacterium fabrum C58

Annotation: conjugal transfer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 822 TIGR00929: type IV secretion/conjugal transfer ATPase, VirB4 family" amino acids 8 to 813 (806 residues), 754.4 bits, see alignment E=7.4e-231 PF27097: VirB4_TrbE_N" amino acids 27 to 132 (106 residues), 124.3 bits, see alignment E=3.9e-40 PF03135: CagE_TrbE_VirB" amino acids 188 to 400 (213 residues), 178 bits, see alignment E=4.8e-56

Best Hits

Swiss-Prot: 89% identical to TRBE_RHIRD: Conjugal transfer protein TrbE (trbE) from Rhizobium radiobacter

KEGG orthology group: K03199, type IV secretion system protein VirB4 (inferred from 100% identity to atu:Atu6038)

Predicted SEED Role

"Conjugative transfer protein TrbE" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D2P4 at UniProt or InterPro

Protein Sequence (822 amino acids)

>Atu6038 conjugal transfer protein (Agrobacterium fabrum C58)
MVALKQFRHSGPSFADLVPYAGLVDNGVILLKDGSLMAGWYFAGPDSESSTDAERNEVSR
QINMILSRLGSGWMIQVEALRVPTIDYPAEDACHFPDPVTRAIDAERRSHFERESGHFES
RHALILTWRPPEPRRSGLTRYVYADAGSRSATYADTALDSFRTSIREVEQYLANVVSIRR
MMTQETQERGGFRRARYDELFQFIRFCITGENHPIRLPDIPMYLDWLVTAELQHGLTPTI
ENRFLGVVAIDGLPAESWPGILNSLDLMPLTYRWSSRFVFLDEQEARSRLERTRKKWQQK
VRPFFDQLFQTQSRSVDQDAMMMVAETEDAIAQAASQLVAYGYYTPAIILFDEVQPRLQE
KCEAIRRLIQAEGFGARIETLNATDAFLGSLPGVSYANIREPLVNTRNLADLIPLNSVWS
GNPVAPCPFYPAGSPPLMQVASGSTPFRLSLHVDDVGHTLVFGPTGSGKSTLLALIAAQF
RRYAGAQIFAFDKGRSMLPLTLAIGGDHYEIDGDAAGEGEGASPRLAFCPLAELSTDGDR
AWAAEWIETLVALQGVTVTPDYRNAISRQLVLMAESRGRSLSDFVSGVQMREIKDALHHY
TVDGPMGQLLDAEEDGLALGAFQCFEVEELMNMGERNLVPVLLYMFRRVEKRLTGAPSLI
IIDEAWLMLGHPTFRDKIREWLKVLRKANCAVVLATQSISDAERSGIIDVLKESCPTKIC
LPNGAAREPGTREFYERIGFNERQIEIVATAMPKREYYVASPEGRRLFDMSLGPVALSFV
GASGKEDLKSIRALHSENGADWPIHWLQQRGIAHAETLFPAA