Protein Info for Atu6035 in Agrobacterium fabrum C58

Annotation: conjugal transfer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 59 to 78 (20 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details TIGR02783: P-type conjugative transfer protein TrbL" amino acids 29 to 320 (292 residues), 322.1 bits, see alignment E=1.8e-100 PF04610: TrbL" amino acids 66 to 270 (205 residues), 112 bits, see alignment E=1.8e-36

Best Hits

Swiss-Prot: 82% identical to TRBL_RHIRD: Conjugal transfer protein TrbL (trbL) from Rhizobium radiobacter

KEGG orthology group: K07344, type IV secretion system protein TrbL (inferred from 100% identity to atu:Atu6035)

Predicted SEED Role

"Conjugative transfer protein TrbL" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D2P7 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Atu6035 conjugal transfer protein (Agrobacterium fabrum C58)
MVVVRPSRRLEMTFIVMAIVLLATAPAFAQQGTVLTTLENQVVTAAKGWETTILNAARSL
FWILAGIEIGIAAVWLAINAASLDAWFAELVRRIMFIGLFAFILERGPALAKAVVDSLFQ
IGAGGGSASPANIFDAGIRVASKMSEQAKFGLFEDNALAIAAVFAMVVVVVSFSLVAAIF
VAVMVEMYVGLLAGMIMLGLGGSSYTKDFAVRYLVYAFSVGMKLMALVMIAKIGSDILIG
LAEAPTATSDQFITTLAIAGISVVVFVIAMYVPPIIQGVVQGASVSGGMEAIRHGGQTAA
FAAGGAFLGAGAAMKGAQSASTARAEGSSMAGAALRGMASGIGNAGWAAGSAAKEKAIAS
PGAYAGSLLGLANAKLDQTRQSGRPSAPPPPPPVNENK