Protein Info for Atu6034 in Agrobacterium fabrum C58

Annotation: conjugal transfer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details PF04335: VirB8" amino acids 14 to 217 (204 residues), 121.4 bits, see alignment E=2.5e-39

Best Hits

Swiss-Prot: 93% identical to TRBF_RHIRD: Conjugal transfer protein TrbF (trbF) from Rhizobium radiobacter

KEGG orthology group: K03200, type IV secretion system protein VirB5 (inferred from 100% identity to atu:Atu6034)

Predicted SEED Role

"Conjugative transfer protein TrbF" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z2PR26 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Atu6034 conjugal transfer protein (Agrobacterium fabrum C58)
MAGRTPPDNPYIAARTEWNERYGSYVKAAAAWRLVGVTGMIMAVIGFSYALYQSTQVKLV
PYIVEVDKLGTASNAGFPQQIEYADPRVVRATLGSFVSNFRSVTPDAVVQKQYIDRTYAL
LRTSDPATEKVNAWFRSSSPFEKAKNATVAVEVNNIVALSNQSYQIDWTEFERDRRGKET
ATRRFRSIATVTLTPPQDEGVIRLNPIGLYLRDLDWTAQL