Protein Info for Atu6019 in Agrobacterium fabrum C58

Annotation: D-nopaline dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF12831: FAD_oxidored" amino acids 8 to 45 (38 residues), 29.9 bits, see alignment 1.3e-10 PF01266: DAO" amino acids 8 to 50 (43 residues), 30.5 bits, see alignment 9.8e-11 PF07992: Pyr_redox_2" amino acids 8 to 319 (312 residues), 63.9 bits, see alignment E=5.9e-21 PF00890: FAD_binding_2" amino acids 8 to 45 (38 residues), 24.4 bits, see alignment 5.7e-09 PF13450: NAD_binding_8" amino acids 11 to 45 (35 residues), 30.9 bits, see alignment 9.5e-11 PF04324: Fer2_BFD" amino acids 378 to 430 (53 residues), 31.7 bits, see alignment 5.7e-11 PF17806: SO_alpha_A3" amino acids 394 to 460 (67 residues), 31.7 bits, see alignment E=5.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu6019)

MetaCyc: 100% identical to nopaline oxidase subunit A (Agrobacterium tumefaciens)
1.5.-.-

Predicted SEED Role

"D-nopaline/octopine oxidase subunit A @ Opine oxidase subunit A"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CL06 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Atu6019 D-nopaline dehydrogenase (Agrobacterium fabrum C58)
MNHHSSADLLIVGAGPAGMAAARRAVRGGLSVIVLDSQSQPGGQIWRNAGRNATSPIINI
LGAEYRRGVRQVEAFLACGADYIPDAQVSRLSQGWTVEYVWGGEIRSVRGRHLLLATGAQ
ERPVPFTGWTLPGVMTVGAAQILLKTAGQLPRGPVAVVGSGPLPLLYMQQMRLAGAKPVA
HLDTTPRGLISRSLRGFRGALQEPGQILKGIAWLPQFSGVRHVRNVVKISAKGSGRLETV
RFETSSGRSDRLEVKSLLVHEGLVPSHQLAVSAGAQLMWDVGQSAFRLERDEWMNAGPDG
LYIAGDGARIGGAVNAEIEGEIAAIGVLLRDGALTAAQADTETKPLRAQHGRQKSFRRFL
DGAYPPNIARTPPDDATIVCRCEELSAGVLREAAVRGACRGPNQLKSFTRAGMGPCQGRQ
CGYPVHELVKSVAGLTAGEVGLFNPRPPFVPLTVSMLAAQQAEEVVSASTHE