Protein Info for Atu5534 in Agrobacterium fabrum C58

Annotation: ABC transporter nucleotide binding/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR03411: urea ABC transporter, ATP-binding protein UrtD" amino acids 5 to 244 (240 residues), 348 bits, see alignment E=1.5e-108 PF00005: ABC_tran" amino acids 22 to 175 (154 residues), 102.8 bits, see alignment E=3.7e-33 PF12399: BCA_ABC_TP_C" amino acids 222 to 245 (24 residues), 30.1 bits, see alignment (E = 4.3e-11)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 100% identity to atu:Atu5534)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtD" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D2U3 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Atu5534 ABC transporter nucleotide binding/ATPase (Agrobacterium fabrum C58)
MSAIALTVDGLSVEFGGFKAVSNVSITVRDGELRVLLGANGAGKTTLMDLISGKTRSTQG
KVFVYDTDITNWPEHNIARAGIGRKFQIPSIFRDLTVRQNLEVANCRNPSVFANLRFGFS
PAEANRVDEVLALTGLEAEKDVTAAYLSHGQTQWLELGMLIVQDPKVILLDEPTAGMTQA
ETRKTAQIIKNLKGRHTILVVEHDMGFVREIAEYITVLHLGEVLAEGSVGDIEHNPKVRE
AYLGSKGIS