Protein Info for Atu5498 in Agrobacterium fabrum C58

Annotation: oxidoreductase with iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF00111: Fer2" amino acids 3 to 53 (51 residues), 39.1 bits, see alignment E=5.8e-14 PF01799: Fer2_2" amino acids 71 to 159 (89 residues), 95.1 bits, see alignment E=2.2e-31

Best Hits

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 100% identity to atu:Atu5498)

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT @ 4-hydroxybenzoyl-CoA reductase, gamma subunit (EC 1.3.99.20)" (EC 1.3.99.20)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.20

Use Curated BLAST to search for 1.3.99.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CL42 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Atu5498 oxidoreductase with iron-sulfur subunit (Agrobacterium fabrum C58)
MQFTINGTAVEVEADIRTSLLDLMRNYLGFTGTKKGCDQGACGACTVLVDGERINSCLAL
AVQYQGRSITTVEGLAANGNLHPLQKAFIEHDGFQCGYCTPGQLCSAIGMAGEIERNIPS
VVTADLSSNSITVDDTEIRERMSGNLCRCGAYNGIVEAISDTLVQQTAVPSEERARA