Protein Info for Atu5412 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to atu:Atu5412)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CL87 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Atu5412 ABC transporter membrane spanning protein (Agrobacterium fabrum C58)
MKASGFPYVIPMLLLSVAFFATPLAVLVGFSFIGPDGLSLHNYARFLGDAFNYRVLINTA
KLGAQTIVTTTLLGVPIALLYWHSGKTARQIIIFLTLIPMLTSNVVRTFAWIVILGRQGP
ISETFVALGLAERPFTLMSTELGLVMAMCQIDLPLIILPLVAILSRIPVTYTEAAQVSGA
GPWRILVTVLLPMMLPGLLAGWILVFASTSASFVTQAVIGGARNVYVPQLIYREVGTLFD
WPMASAIAVVLLMSTGMLLVAMTMISRHRRLVGHA