Protein Info for Atu5409 in Agrobacterium fabrum C58

Annotation: ABC transporter substrate binding protein (amino acid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00497: SBP_bac_3" amino acids 66 to 290 (225 residues), 83.8 bits, see alignment E=9.3e-28 PF09084: NMT1" amino acids 101 to 250 (150 residues), 29.3 bits, see alignment E=7.8e-11

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 100% identity to atu:Atu5409)

Predicted SEED Role

"ABC transporter, substrate binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CL88 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Atu5409 ABC transporter substrate binding protein (amino acid) (Agrobacterium fabrum C58)
MHSFKQTLTATLAGAAFALLASTTQAAEGKPVTIAPEADIAKLPGVAFNQDLADRLPSAI
KDKKVVKVATDLTPPISFQDEAGKLIGIDADLAAALGVILGVDVQMTNVGAGAAIVPAVL
SKRFDMTLSGINDDVELEKQVDVIDYMYDATTIMTIKGNPLSIKSMEDLCGKKVAVPVGT
FQNRLVVAASAKCKTTPIEIISIPKMPDVLQAVRTGRADATVNGYATSVYTTEKQTGKGV
GLQALPDVRLTVGYLGMLVSKDNPELRDAVIASLQHMVDSGAYQTIMEKWSLGPLAVKTV
KFNDAASMPVD