Protein Info for Atu5401 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 184 to 212 (29 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 269 (182 residues), 46.8 bits, see alignment E=1.5e-16

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu5401)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U5S6 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Atu5401 ABC transporter membrane spanning protein (sugar) (Agrobacterium fabrum C58)
MHEYEAYQPSLTERLRGGLSTVILVIAAITPILWMILSSFKDRYEVTKLPPSLFFTPTLD
NYRQLFERTEFLSNTLNSLIVSTGATLLGIMLAFPAAFAVSWHRTTWPATLALFSRMAPG
TLFLLPWFIIFSELGLVGSYTVLILTHAVIAMPVALWTMLPYFDAMPRELVEAAQMDGCR
PLSVLWRIVLPVVMPGVVVSSILCFIFTWNYFLFALALSGFDTKTAIVASFNFIGEGVTN
WGALMAAATMIALPPLILTLLVQRRLVAGLSAGAVKG