Protein Info for Atu5391 in Agrobacterium fabrum C58

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5391)

MetaCyc: 34% identical to 3-hydroxykynurenate reductase/dehydratase (Streptomyces sp. SNA15896)
1.17.1.-

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.10)

MetaCyc Pathways

palmitate biosynthesis III (28/29 steps found)
anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
fatty acid elongation -- saturated (5/5 steps found)
3-hydroxyquinaldate biosynthesis (2/8 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.10

Use Curated BLAST to search for 1.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CL99 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Atu5391 short chain dehydrogenase (Agrobacterium fabrum C58)
MDRLKSKRALITGGTSGIGLETARQFISEGARVAVTGTNPETLDAARRELGPSALVIKAD
AADVDGQKVVAETIREAFGGLDVVFINAGVALLKPLEAWDEKGFDRVFNINVKGPYFLLQ
ALLPILANPASIVLNTSVNAHIGMPNSSVYAASKAALQSFIRTLSGELIARGIRLNAVSP
GPISTPLYGKLGFTETDLKNVAESIQNLVPAGRFGEPSEIAKAVVFLASDEAAYTVGSEI
MIDGGMGTL