Protein Info for Atu5324 in Agrobacterium fabrum C58

Annotation: zinc-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF08240: ADH_N" amino acids 31 to 127 (97 residues), 70.3 bits, see alignment E=2.3e-23 PF00107: ADH_zinc_N" amino acids 183 to 262 (80 residues), 63.7 bits, see alignment E=2.6e-21 PF13602: ADH_zinc_N_2" amino acids 214 to 335 (122 residues), 87.9 bits, see alignment E=1.8e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5324)

Predicted SEED Role

"Zinc-binding oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLD1 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Atu5324 zinc-binding oxidoreductase (Agrobacterium fabrum C58)
MIEMMKAVRLHEFGGPEVLSYEEAPRPVAASGEVLVRVHAAGINPPDLYLRDGYRTLPPE
WQPEPTFPLILGTDVSGVVAAIGDGVSAFSVGDEVFAMVRFPEDLMQGSGAYAEYVTVPA
SELALKPAGIDHIQAAGAPMSLLTAWQFLVDLGHDAPNPFQSFRHSPIPLQGKTVLVNGA
GGGVGHLAIQLAKWRGAHVIAVASGKHEALLRALGADQIIDYTKTAAETAAEDVDLVIDA
VGGSNMERFLNVVRPGGALFLVNPLGFSAHKDAARCGITVSSTQVRSNGAQLAEAGRLLN
DGSIRVVIDSTSPLAEAAAAHERASGGGIQGKIVLFAG