Protein Info for Atu5316 in Agrobacterium fabrum C58

Annotation: ABC transporter nucleotide binding/ATPase (iron-siderophore)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 PF00005: ABC_tran" amino acids 28 to 176 (149 residues), 103.6 bits, see alignment E=2.8e-33 PF13514: AAA_27" amino acids 30 to 61 (32 residues), 22 bits, see alignment 2.2e-08 PF13304: AAA_21" amino acids 39 to 63 (25 residues), 28.9 bits, see alignment (E = 2.4e-10)

Best Hits

Swiss-Prot: 62% identical to FEPC_ECOLI: Ferric enterobactin transport ATP-binding protein FepC (fepC) from Escherichia coli (strain K12)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to atu:Atu5316)

MetaCyc: 62% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLD5 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Atu5316 ABC transporter nucleotide binding/ATPase (iron-siderophore) (Agrobacterium fabrum C58)
MTDRPDTRIERLEVQNATLRYNQRIIAEDLSVKIPDGSFTVIVGPNACGKSTLLRALSRL
LTPSAGEVILDGKAIAGYPAKQLARAIGLLPQSSIAPDGITVAELVARGRYPHQSLFRQW
SSEDEAAVALAMAATQTTQLSTRLVDELSGGQRQRVWVAMVLAQETPILLLDEPTTFLDI
AHQIDLLDLCQELNAAGRTIVAVLHDLNHACRYATNIIAMRDGAIIAHGSPPTTVTERLV
EDVFGLPCMIIPDPVSGTPLIVPKVKVRAACIPITPDIPEH