Protein Info for Atu5315 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (iron)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 61 to 80 (20 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 234 to 261 (28 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details PF01032: FecCD" amino acids 18 to 323 (306 residues), 261.8 bits, see alignment E=3.8e-82

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to atu:Atu5315)

Predicted SEED Role

"Ferric enterobactin transport system permease protein FepG (TC 3.A.1.14.2) @ ABC-type Fe3+-siderophore transport system, permease 2 component" (TC 3.A.1.14.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3D5 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Atu5315 ABC transporter membrane spanning protein (iron) (Agrobacterium fabrum C58)
MRFDPRSLFVGVILLSLTVMIGAASLASGKFPVPSADVFKALLGAADSTMNMVVMEWRLP
RLFLAFLLGGALGLSGAIFQSLTHNPLGSPDIIGFSAGSYTGALVVIFVCSGGYYETAAG
ALAGGVVTAAAIYLLAYRGGLQSFRLIVVGIGISAMLNALNAWMIRQADLKVAMSAAIWG
AGSLNGLGFEQVWQVLLMLATIIPCVLALARPMRQLELGDDMATASGIHVNRLRLILMIC
GVALTAIVTAAAGPIAFVSLAAPQIARRLSGSGGVTLLPSALTGGLLLIAADWAAQHAFG
AQLPVGIMTVSVGGFYFLWLLIREARQ