Protein Info for Atu5307 in Agrobacterium fabrum C58
Annotation: related to citrate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01647, citrate synthase [EC: 2.3.3.1] (inferred from 100% identity to atu:Atu5307)Predicted SEED Role
"Citrate synthase (si) (EC 2.3.3.1)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 2.3.3.1)
MetaCyc Pathways
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
- superpathway of glyoxylate bypass and TCA (12/12 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
- TCA cycle I (prokaryotic) (10/10 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (12/14 steps found)
- TCA cycle III (animals) (9/10 steps found)
- glyoxylate cycle (6/6 steps found)
- TCA cycle II (plants and fungi) (8/9 steps found)
- TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
- TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
- TCA cycle VII (acetate-producers) (8/9 steps found)
- partial TCA cycle (obligate autotrophs) (7/8 steps found)
- TCA cycle VI (Helicobacter) (6/9 steps found)
- nitrogen remobilization from senescing leaves (5/8 steps found)
- methylaspartate cycle (12/19 steps found)
- ethene biosynthesis V (engineered) (16/25 steps found)
- mixed acid fermentation (9/16 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Glyoxylate and dicarboxylate metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.3.1
Use Curated BLAST to search for 2.3.3.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q7D3E2 at UniProt or InterPro
Protein Sequence (406 amino acids)
>Atu5307 related to citrate synthase (Agrobacterium fabrum C58) MVNLDLYNQYEIIMRHSDKFMTADRAAAELGISRATLYAYVSRGMIHTSDAADDPRRRLY SAHDIEALKKRKNVGRRPRQVAAAALDWGLPVLESAITEIAEGQLRYRGQDALALSQAAS LEDVARLLWDCGEVDPFDDLKAAPTPWPQPVLDYVRDLPLTERCQALLPLLEAGRVTTWR RDNRRLWPGAAALLRGIAGACISSQPKTQAVHLSLADAWQTDAAGADLIRRALVLQADHE LNTSAFAVRVVASTGASLGACLNAGLSALSGPLHGGMTSLVEILFDELDRYGDVERVIDE RLRRGEAIPGFRHPLYPDGDPRATGLLLYLPPDAQRDELLQMMNDTTGQLPTCDVALVSL RRSLKLPRGAALALFAVARTVGWVAHALEQKLDDKLIRPRARYIGR