Protein Info for Atu5306 in Agrobacterium fabrum C58

Annotation: citrate synthase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 87 to 110 (24 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details PF00285: Citrate_synt" amino acids 15 to 357 (343 residues), 337.1 bits, see alignment E=6.2e-105

Best Hits

KEGG orthology group: K01647, citrate synthase [EC: 2.3.3.1] (inferred from 100% identity to atu:Atu5306)

Predicted SEED Role

"Citrate synthase (si) (EC 2.3.3.1)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 2.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.3.1

Use Curated BLAST to search for 2.3.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3E3 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Atu5306 citrate synthase 2 (Agrobacterium fabrum C58)
MSATPALVGKNPAPGLDDVVAAETMLSHVDGQAGELVVRGHHLAELADWSFEQVLELLWS
GQTATKITAEDIRSQLGKARLRAFELMQLLFPGLAALTSVEALRLLLSWLPDDETTPHHL
VAVAAVPVFATAIIRNRQGFAPIAPDASLTHSADFLRMLSGTLPSTEKVRALDTYLTTVA
DHGLNASTFTARVIASTGAGLFSSVVGALCALKGPLHGGAPGPVLDMLDAIGAEAEIEPW
LLDALGRGERLMGFGHRIYRVRDPRADVLKHAVSTLKEGSDRIAFAGKVEEAALALLKEK
KPLRPLQTNVEFYTALVLEAVGFPRDSFTNVFAAGRMAGWTAHVLEQERTGRLIRPQSHY
IGPHPR