Protein Info for Atu5266 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 201 to 226 (26 residues), see Phobius details PF17200: sCache_2" amino acids 48 to 190 (143 residues), 118.2 bits, see alignment E=9.9e-38 PF17201: Cache_3-Cache_2" amino acids 74 to 191 (118 residues), 51.6 bits, see alignment E=2.6e-17 PF08269: dCache_2" amino acids 76 to 184 (109 residues), 94 bits, see alignment E=2.8e-30 PF07730: HisKA_3" amino acids 250 to 317 (68 residues), 58.4 bits, see alignment E=2.6e-19 PF13581: HATPase_c_2" amino acids 339 to 447 (109 residues), 34.4 bits, see alignment E=6.1e-12 PF02518: HATPase_c" amino acids 358 to 451 (94 residues), 52.1 bits, see alignment E=2.5e-17

Best Hits

Swiss-Prot: 63% identical to MCTS_RHIL3: Sensor histidine kinase MctS (mctS) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K02480, two-component system, NarL family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to atu:Atu5266)

Predicted SEED Role

"Sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3H3 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Atu5266 two component sensor kinase (Agrobacterium fabrum C58)
MRLRNQILALAIGPLVLAIIIITALITWQSMTLARTSIDAFERNMLAAKEAELLNLTNLA
LSAIRSVYDKAGPDDEAAKKEVKRILMDLDYGTDGYFFVYDYDGLNVVHPRQNFRPGNNW
LDLYDPDGNRVIYDLIVKAKEGGGLVQYKWEKPSTRKIADKLSFAAGLDKWRWMIGTGVY
LDDVFAATAAAKEELRHSITWNFLIVALFAVPAVLLVFATCMLLNLRQQRLADGRLKELM
QRVIDTQDEERLRIARELHDGISQNLVGVRFAIDLARRKVTPDNVGAVEAIGKGASALTE
AIKEVRRISHDLRPRVLDDLGLTAALEALISSFSERTGIAATLESVAFKHMLVPEARVAL
YRVAQEALTNIERHSDATRVTIRFSSRDERVQMVVSDNGRGFPATRTENEMPADKGLGLR
NMQERMTHFGGRLDVESSAKGTVLRAVLPMTAMKDHGPRLQEAAE