Protein Info for Atu5256 in Agrobacterium fabrum C58

Annotation: ABC transporter nucleotide binding/ATPase (oligopeptide)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF00005: ABC_tran" amino acids 25 to 183 (159 residues), 100.6 bits, see alignment E=1.7e-32 PF13304: AAA_21" amino acids 150 to 218 (69 residues), 30.1 bits, see alignment E=7.4e-11 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 232 to 315 (84 residues), 83 bits, see alignment E=6.4e-28 PF08352: oligo_HPY" amino acids 234 to 298 (65 residues), 77.4 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 49% identical to OPPD_ECOLI: Oligopeptide transport ATP-binding protein OppD (oppD) from Escherichia coli (strain K12)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to atu:Atu5256)

MetaCyc: 49% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLH2 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Atu5256 ABC transporter nucleotide binding/ATPase (oligopeptide) (Agrobacterium fabrum C58)
MSAMLEIKGLKTEVVTDEGNITLIDDITLSLAAGEVMGLVGESGSGKSVTGLSIMGLLDK
PVQMTGGKILFKGRDLRSASQKELRSIRGNRIAMIFQDPMSTLNPVLRIDTQMMEVVHAH
ENVSKQVARERARDALGMVGIPSPEERLSAYPHQFSGGMRQRVAIAIALLMSPDVIIADE
PTTALDVTIQAQILSIVQKLAREKGTALIWVTHDLSVVAGLAEKLSVMYAGRIVEQGLTA
DLLRRPLHPYTNGLIASLPAHNKRGERLRQISGTTPSVANMPKGCAFHPRCSFATEICLN
SPALEPTEGRLLRCFHPVMEGAPS