Protein Info for Atu5251 in Agrobacterium fabrum C58

Annotation: pyridoxal phosphate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF00202: Aminotran_3" amino acids 49 to 436 (388 residues), 260.4 bits, see alignment E=2.4e-81

Best Hits

Swiss-Prot: 42% identical to AT2L1_BOVIN: Ethanolamine-phosphate phospho-lyase (ETNPPL) from Bos taurus

KEGG orthology group: None (inferred from 100% identity to atu:Atu5251)

Predicted SEED Role

"Aminotransferase class-III (EC 2.6.1.40)" (EC 2.6.1.40)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3I8 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Atu5251 pyridoxal phosphate aminotransferase (Agrobacterium fabrum C58)
MSATTKEILDLNRFDASRTEGFPAELAERVAKRQATFGASSVLFYEQPIEMVSAQGAYLY
DAGGRKYLDVYNNVPSVGHCHPRVVEAIARQVGELNIHTRYLNRVVEAYTENLLSKFPAG
LSNVVLTCTGSESNDLALRIARIGTGAEGFIVTEAAYHGNTALVTEVSPSSLRKRKPAAF
VAIIPAPAARDGMSVASNFAASVEQAINELNSRGIKFAALIVDTIFSSDGIYADPAGFLK
EAVDVVHRAGGLLIADEVQPGFGRTGGSLWGFERHGVTPDIVTMGKPMGNGFPMGGVVTR
PDLLQRFCEETGYFNTFGGNPVAAAAGHAVLRVIEEEGLIERSATVGGYFKQSLQALQSR
HSEIGDVRGAGLFIGLDFVDPATGEPDSTRATHAINQLRHNSILIGAAGKYGATLKIRPP
LCFSNEDVDLFTGTLDIILQARRAA