Protein Info for Atu5219 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (glycine betaine/L-proline)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 141 to 167 (27 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 111 to 273 (163 residues), 82.9 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 45% identical to PROW_SALTY: Glycine betaine/proline betaine transport system permease protein ProW (proW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to atu:Atu5219)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3M0 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Atu5219 ABC transporter membrane spanning protein (glycine betaine/L-proline) (Agrobacterium fabrum C58)
MFDANDLAVFPIDAWIADGVQWIALNLRPLFVAIKWPIENLLAFNDHILHAIPFPIFLVL
SFLIAYRLASLGIAIFTAISFVVIASLGVWDESMTTLSLISTAIVISTVIGIPVGIWCAI
NNSVWQVVRPVLDIMQTTPTFVYLVPVVMLFGVGTVPGEVAVVIAAAPPLIRFTNLGIRM
VETEMVEAGLAFGADRRQLLWEIQFPLAIPTILGGLNQTVLTAMVMSVVVAMIGAEGLGL
VVLQGLGRLDVGRAAVGGIAIILLAMILDRITQKLAMPATSKAKRSFRTTLSTVLMGARS
KPSAGTA