Protein Info for Atu5181 in Agrobacterium fabrum C58

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00106: adh_short" amino acids 7 to 194 (188 residues), 176.7 bits, see alignment E=9.8e-56 PF08659: KR" amino acids 10 to 114 (105 residues), 33.2 bits, see alignment E=1.2e-11 PF13561: adh_short_C2" amino acids 13 to 242 (230 residues), 212.7 bits, see alignment E=1.5e-66 PF23441: SDR" amino acids 100 to 243 (144 residues), 33.1 bits, see alignment E=1e-11

Best Hits

Swiss-Prot: 35% identical to YGFF_ECOLI: Uncharacterized oxidoreductase YgfF (ygfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to atu:Atu5181)

MetaCyc: 39% identical to NAD(P)+-dependent L-rhamnose 1-dehydrogenase (Sphingomonas sp. SKA58)
RXN-12158 [EC: 1.1.1.378]; L-rhamnose 1-dehydrogenase. [EC: 1.1.1.378, 1.1.1.173]

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.10

Use Curated BLAST to search for 1.1.1.173 or 1.1.1.378 or 1.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLL6 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Atu5181 short chain dehydrogenase (Agrobacterium fabrum C58)
MSELAGKRALVTGASRGIGAAIAIALAEKGADVAITYERAADRAAQVVATIEGKGRKALA
IQADSMDPEAVKRSVDQAAQALGGLDILVNNAAIAIYKDVADFTVAEIDALFAVNARSPI
LASQAAMPYLGKGGRIVTIGSAGAERIVGPSTVYSMTKSALQSFTRGLARELGPRDITVN
LIQPGSTNTEMNPAEGEFGDFQRALIPLGRYGEPEDVAAAVAFLASGAARQITGTILTVD
GGTLT