Protein Info for Atu5136 in Agrobacterium fabrum C58

Annotation: transcriptional repressor of the blcABC operon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF09339: HTH_IclR" amino acids 28 to 77 (50 residues), 44.9 bits, see alignment 1.2e-15 PF12802: MarR_2" amino acids 31 to 81 (51 residues), 32.4 bits, see alignment 1.2e-11 PF01614: IclR" amino acids 147 to 266 (120 residues), 78.2 bits, see alignment E=7.9e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5136)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3U3 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Atu5136 transcriptional repressor of the blcABC operon (Agrobacterium fabrum C58)
MGQRGQVCQGRCMAEDQQSSQISDTVPALRRAVRILDLVAGSPRDLTAAELTRILDLPKS
SAHGLLAVMTELDLLARSADGTLRIGPHSLRWANGFLSHLDIVSTFNDHLAQRHDLDPYT
VTLTVREGGEVVYIGCRNSAQPLGHTFRIGMRLPAPFTATGKILLSDLGPGELRMLFSQF
PQPLTSRSVAGLSQLEEELALTRARGYSIDDGQIREGMLCIGAAIRDYSGAASAGIAISL
IRSEASDEKIASLGEELRTTANALSEKLGYRSQKD