Protein Info for Atu5123 in Agrobacterium fabrum C58

Annotation: acetolactate synthase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02776: TPP_enzyme_N
  • amino acids 9 to 120 (112 residues), 83.5 bits, E=1.5e-27
• PF00205: TPP_enzyme_M
  • amino acids 198 to 335 (138 residues), 123.4 bits, E=8.3e-40
• PF02775: TPP_enzyme_C
  • amino acids 405 to 550 (146 residues), 128.4 bits, E=3.1e-41

Best Hits

KEGG orthology group: K01652, acetolactate synthase I/II/III large subunit [EC: 2.2.1.6] (inferred from 100% identity to atu:Atu5123)

Predicted SEED Role

"putative acetolactate synthase large subunit"

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to (R)-acetoin I (3/3 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• superpathway of (R,R)-butanediol biosynthesis (4/5 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• L-isoleucine biosynthesis II (5/8 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• L-isoleucine biosynthesis IV (3/6 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See A9CLM7 at UniProt or InterPro

Protein Sequence (571 amino acids)

>Atu5123 acetolactate synthase catalytic subunit (Agrobacterium fabrum C58)
MDTAVHETTVAERIAKALRRHDVEVIFGQSLPSAVILAAEKIGITQIAYRQENMGGAMAD
GYARRSGKIGIVAAQNGPAAALLVAPLAEALKASVPVVALVQDVERDQTDRNAFQDLDHI
GLFQSCTKWVRRVSVEERIDDYIDAAFTAASSGRAGPAVLLLPADLLRSVSTTPSRRRTN
NLGHWPLDRSRPADKDLDIAAKAIANARAPVVIAGGGIHASGAAQQLRLLQDECSIPVFT
TNMGKGSVDEWHPLSGGVLASLVGPKSLGRHTVEIVREADLVVLIGTRTNQNGTDNWRQY
SPDAQIIHIDTDPQEVGRNFEAIRLVGDARETLAGLRERIRLCDLHLRTVSREAVCNRLR
ESWRKFNDDRRGYYSSEASPLRPERIMAELQGVIDENTTVVADASYSSMWVLGQLRISSE
RTRVLTPRGLAGLGWGVPLAIGAKVAAPESDVVALVGDGGFAHSWAELETLVRMQIPITI
IVLNNGILGFQRDAETVKFGKYTTACHFAEVDHVKIAHACGCDAVRVTQPQDLKAHMQKV
KKRKLPLLIEAMTDPEAHPALSLFAQMDSAA