Protein Info for Atu5108 in Agrobacterium fabrum C58

Annotation: conjugal transfer coupling protein TraG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details TIGR02767: Ti-type conjugative transfer system protein TraG" amino acids 10 to 634 (625 residues), 1171.6 bits, see alignment E=0 PF02534: T4SS-DNA_transf" amino acids 164 to 633 (470 residues), 326.3 bits, see alignment E=5.4e-101 PF10412: TrwB_AAD_bind" amino acids 451 to 596 (146 residues), 57.9 bits, see alignment E=1.3e-19 PF12696: TraG-D_C" amino acids 474 to 595 (122 residues), 86.7 bits, see alignment E=1.9e-28

Best Hits

Swiss-Prot: 56% identical to VIRD4_BARHE: Type IV secretion system-coupling protein VirD4 (virD4) from Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1)

KEGG orthology group: K03205, type IV secretion system protein VirD4 (inferred from 100% identity to atu:Atu5108)

Predicted SEED Role

"Type IV secretion system protein VirD4" in subsystem Type 4 secretion and conjugative transfer or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLN6 at UniProt or InterPro

Protein Sequence (639 amino acids)

>Atu5108 conjugal transfer coupling protein TraG (Agrobacterium fabrum C58)
MKGKAKQHPSLLLITIPIAVTGFSFYVAHWRWPELAAGITGKTQYWFLRASPLPVLLFGP
LAGLLAVWALPLHRRRPVALASFLCFFLVAGFYGMREFGRLQPLVESGVLTWDQALSFVD
MIAVVGAAMGFMAAAVAARISSVVPEQVTRARRGTFGDADWLPMSAAARLFPDDGEIVIG
ERYRVDKELIHELPFDPNDPATWGRGGKAPLLTYAQDFDSTHMLFFAGSGGFKTTSNVVP
TALRYTGPLICLDPSTEVAPMVVDHRRDKLDREVVVLDPANPVMGFNVLDGIEHSLKKEE
DIVGIAHMLLSESVRFESSTGSYFQSQAHNLLTGLLAHVMLSPEYAGQRNLRSLRQIVSE
PENSVLAMLRDVQEHSASAFIRETLGVFVNMTEQTFSGVYSTASKDTQWLSLDNYAALVC
GNTFKSSEIAGGKKDVFINIPASILRSYPGIGRVIIGSLINAMIEADGAFTRRALFILDE
VDLLGYMRVLEEARDRGRKYGVSMMLMYQSVGQLERHFGKDGAVSWIDGCAFASYAAIKA
LDTARNVSAQCGEMTVEVKGSSRNLGWGTKNSASRKSENINFQRRPLIMPHEITQSMRKD
EQIIIVQGHSPIRCGRAIYFRRKDMDMHARPNRFAKLGP