Protein Info for Atu5094 in Agrobacterium fabrum C58

Annotation: ISL3 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 PF14690: Zn_ribbon_ISL3" amino acids 38 to 81 (44 residues), 36.7 bits, see alignment 4.4e-13 PF01610: DDE_Tnp_ISL3" amino acids 157 to 281 (125 residues), 61.2 bits, see alignment E=1.4e-20 amino acids 396 to 512 (117 residues), 29.2 bits, see alignment E=8.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5094)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3X6 at UniProt or InterPro

Protein Sequence (517 amino acids)

>Atu5094 ISL3 family transposase (Agrobacterium fabrum C58)
MSTKFRASDLVPAGFTAERITHIDDETRIVLSRAVASAACPACGRMSRTVRSRYCRQVAD
LPLSGKRVRLLVQTRRFACDAVLCGRQIFAERFGEVLLPYARRTGRLEHLVHHLALALGG
RPAARFAQRLMLPVSNDTLLRVIRRQGLPPSTPPSVIGIDDWAWRRNHRYGTIVCDLERR
RPVSLLPDREPATAEAWLRGNPQIEIIARDRGGAYGLAAAKALPDAVQVADRWHLMENAS
RAFLDAVRKSMRQIRKTLKATRVNPKLLTAAERLQYEGYLRREQTNAAIIALAKDGIMIK
EIVRRTGHSRGLVRQVLRGQRNDVFRSRESSLESYFEWLDAQWAAGKRNATELWRRLRTQ
GFRGSRRVVSEWATRRKRADKADAESLTRIPSARTIARLLTNSRDNLTKSETVTIAAIES
GVPLLIAARDIITDFHLMIRRKAENQLTSWIDRARDSLVSSFGNGVVKDIQAVRAAIVSP
WSNGQTEGQITKLKLVKRQMYGRGKLDLLQARLIGAT