Protein Info for Atu5083 in Agrobacterium fabrum C58

Annotation: ABC transporter nucleotide binding/ATPase (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 120.6 bits, see alignment E=1.2e-38 PF17912: OB_MalK" amino acids 235 to 281 (47 residues), 31.5 bits, see alignment 4.1e-11 PF08402: TOBE_2" amino acids 274 to 335 (62 residues), 27.6 bits, see alignment E=4e-10

Best Hits

Swiss-Prot: 55% identical to UGPC_RHOS1: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to atu:Atu5083)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3Y5 at UniProt or InterPro

Protein Sequence (371 amino acids)

>Atu5083 ABC transporter nucleotide binding/ATPase (sugar) (Agrobacterium fabrum C58)
MSGVELKGVSKSFGAVDVIHDIDLSITAGEFVVFVGPSGCGKSTLLRLIAGLEETSRGEI
LIGGRDVTDADPSDRGIAMVFQSYALYPHMTVAQNMGFGLRMAHRPKEEVTAMVRHAAEI
LHLTPLLDRRPGQLSGGQRQRVAIGRAIVRNPEVFLFDEPLSNLDAELRVGMRIEIARLH
KQLGNTMIYVTHDQTEAMTLADKIVVLRAGRIEQIGSPFELYSDPDNLFVAGFIGSPKMN
FVPAGHEAGALVVAGHRLTFAAPAGLPTNCQLQLGIRPENLTLTRDGERGLAVTVGFTEF
LGGTTYLYGHIEPGMPLIVQGEAGPAPLVGQTVFVTSIRQMPDFSMPRGCVFVMLRNVPK
PFQAISFQTAV