Protein Info for Atu5069 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (oligopeptide)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 121 to 301 (181 residues), 112.4 bits, see alignment E=1.1e-36

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu5069)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLQ6 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Atu5069 ABC transporter membrane spanning protein (oligopeptide) (Agrobacterium fabrum C58)
MAIQSPNTVDNSAAKEPVIEEASAFVRMARMLWADKFALCAAIFLILVIILAIIGPTLLN
ELATKQNLRGRNLAPFDFSREWFMWLGADALGRPLWPRIIVATQNTIMVAAGAVFISAVV
GTLLGLIAGFSSQRTSQIIMRLADVIMSFPSLLVAVIVLYILGSSILNLMLVLSITRIPV
YLRTTRAEVMEIRSRMFVQAARVMGASSKRILFRHILPVVLPTLTTLATLDFAYVMLAES
ALSFLGIGIQPPEITWGLMISQGRQYLTNAWWLSFWPGLAIILTTLSLNLLSNWLRIALD
PVQRWRLEMKGPKNG