Protein Info for Atu5065 in Agrobacterium fabrum C58

Annotation: non-heme chloroperoxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00561: Abhydrolase_1" amino acids 22 to 257 (236 residues), 114.4 bits, see alignment E=1.8e-36 PF12146: Hydrolase_4" amino acids 23 to 256 (234 residues), 77.9 bits, see alignment E=2e-25 PF12697: Abhydrolase_6" amino acids 23 to 265 (243 residues), 76.5 bits, see alignment E=1.2e-24

Best Hits

Swiss-Prot: 60% identical to PRXC_PSEFL: Non-heme chloroperoxidase (cpo) from Pseudomonas fluorescens

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 100% identity to atu:Atu5065)

Predicted SEED Role

"Non-heme chloroperoxidase"

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLQ9 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Atu5065 non-heme chloroperoxidase (Agrobacterium fabrum C58)
MSRFTTTDGTRLFYKDWGAGQPILFAHGWPLSSDAWDQQMLFFSQNGFRVIAHDRRSHGR
SDQTFDGNNMDQYADDLAELINALDLSDLILVGHSTGGGEVSHYVGRHGTARVAKVVLVG
AVPPVMLKTVDNPNGTPMEVFDSIRENTAKNRSQFFFDLTVPFYGFNREGVATNDGMREN
FRRIGLQGGVKGQYDCIREFSEVDYTRDLKSIDRPTLIIHGDDDQIVPIDASAHRAADLV
ADATLKIYSGGSHGLAETEADRFNADVLAFIHG