Protein Info for Atu5058 in Agrobacterium fabrum C58

Annotation: ABC transporter substrate binding protein (glycerol-3-phosphate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01547: SBP_bac_1" amino acids 40 to 327 (288 residues), 119.2 bits, see alignment E=3.8e-38 PF13416: SBP_bac_8" amino acids 45 to 351 (307 residues), 150 bits, see alignment E=1.2e-47

Best Hits

KEGG orthology group: K05813, sn-glycerol 3-phosphate transport system substrate-binding protein (inferred from 100% identity to atu:Atu5058)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, periplasmic glycerol-3-phosphate-binding protein (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLR3 at UniProt or InterPro

Protein Sequence (419 amino acids)

>Atu5058 ABC transporter substrate binding protein (glycerol-3-phosphate) (Agrobacterium fabrum C58)
MLQKLQLALAASVLSLAAGVSSADAATTVRFWHSFNKSNGEALDKIIAGFEAANPDTDIE
AEYIGSYNDIIAKLQAAIPARRAPDAVILEVTRYGLFANNNLLTDLTPYFDADPLKDDLY
DYAREVGVINGKNYVVPFNSSTPVLYFNKDIFARAGLPADTPLKTFEDISTAAKTITEKL
GSQGISGIAAPGQFARWGLVMANDSEMIDPKTGEIVLDKPNTIEAYQWMASLVKDSKVAS
PDGVTEEDNGRDAFLARKVGIMMNSTGNYVGSKKALGGDLVVRPMPCNKTCSVPIGGAGI
GIMSTSEKDVQDAAYKFISYAASPEANATWFAGTGYLPINKKSADLPVSKEALATQPGID
VAIESLPVAHGRARTTVVTWMRTTEYKMWEAMALGQRDVDATMKDFAAQTRAEEKRVSN