Protein Info for Atu5023 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 PF11398: DUF2813" amino acids 1 to 72 (72 residues), 30.5 bits, see alignment E=7.5e-11 PF13175: AAA_15" amino acids 1 to 78 (78 residues), 55.6 bits, see alignment E=2.1e-18 amino acids 151 to 322 (172 residues), 66.8 bits, see alignment E=8e-22 PF13514: AAA_27" amino acids 1 to 49 (49 residues), 30.6 bits, see alignment 7.5e-11 PF13476: AAA_23" amino acids 5 to 97 (93 residues), 52.1 bits, see alignment E=4.1e-17 PF13304: AAA_21" amino acids 277 to 321 (45 residues), 36 bits, see alignment 2.3e-12 PF20469: OLD-like_TOPRIM" amino acids 370 to 436 (67 residues), 59.3 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: K07459, putative ATP-dependent endonuclease of the OLD family (inferred from 100% identity to atu:Atu5023)

Predicted SEED Role

"DNA repair protein RecN" in subsystem DNA-replication or DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D433 at UniProt or InterPro

Protein Sequence (577 amino acids)

>Atu5023 hypothetical protein (Agrobacterium fabrum C58)
MHLASLKIKNFRRFSETTIKFKSGLNVIVGPNNIGKSAVVDALRSLLAGADDPYPRFTVD
DIHVPKLGEASGDIVFEFIFDDLDGNDEADFIHALREKPDNKLEAVLNVAFGDADKSGRL
RPRRWCGAFEEVSMSSSMLDNLRSVYLPPLRDAEQGLRPSRNSQLSRLLHLLTDETGKEE
VALHLKDLDAKLKELQVLKDAQSAVSGRHETMLGERLAQVLNVGLTGSDFSKLAARLSLL
VDTFEIERNGLGYNNLIFMAVVLSELSKNAEASFRSLIVEEPEAHLHPQLQAVLLKYLSS
IQNGVGERDVQVFVTSHSPNFASIADLNSIACLYEVDDNVASFHPGSVNFAKGKKEKLKR
YLDVTRAELFFARRVIFVEGAAELLMVNLLATKAGFDLRNHGISLISVEGLNFDSFMPLF
GEAGIKIPVSVITDADPQIEDAGGKKTAHYPSSTEAIIVSDNTKSMKALEDKYLKVFHGQ
KTFEYDFALEDQNRQAMLDALEDIHPVIAKNLRDVVAAEPDDAAKAKALFRGMFEREQNN
VQKGRFAQTLAAKIEDEGLPIVVPPYIRFAVEHACQP