Protein Info for Atu5016 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF07756: DUF1612" amino acids 194 to 320 (127 residues), 172.8 bits, see alignment E=3.7e-55 PF11972: HTH_13" amino acids 329 to 382 (54 residues), 94.3 bits, see alignment 3.5e-31

Best Hits

Swiss-Prot: 82% identical to Y4CF_SINFN: Uncharacterized protein y4cF (NGR_a00080) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to atu:Atu5016)

Predicted SEED Role

"protein of unknown function DUF1612"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLT1 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Atu5016 hypothetical protein (Agrobacterium fabrum C58)
MISMAYDLAKISTSDLMRPAFDAGVALTRLDERIARSPVGQGWIERTHFTEACASLWVDG
ELVHLEDLVLHDATRDIRTPTHELTIARDVLRTRRRIAAQPPDWTLSADGLRTLRQTSEI
ASTGVGEAETAAAIRRVVVTDPEGEGDEVDSGENLPGVDLEAIDAVLARSEAAIESATRP
GRAGGSRATEKDPMVYDLDWDEEARLDEWRGVLRQAQELPAVLQAIVALDAWNELSVLQH
APWLGRLLAASILRHAGVTSGAHLAAINLGLKTIPVDRRRHRDRESRLLAIAHGFLAAAE
IGLKEHDRLILARTMVERKLDGRRTSSKLPELVELVMAKPLVSAGMVAKTLDVTPQAARR
IVLELGLREMTGRGRFRAWGIL