Protein Info for Atu5002 in Agrobacterium fabrum C58

Annotation: replication initiation protein RepC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF03428: RP-C" amino acids 13 to 186 (174 residues), 233 bits, see alignment E=2e-73 PF11800: RP-C_C" amino acids 294 to 394 (101 residues), 149 bits, see alignment E=4.5e-48

Best Hits

Swiss-Prot: 68% identical to REPC_AGRRH: Putative replication protein C (repC) from Agrobacterium rhizogenes

KEGG orthology group: None (inferred from 100% identity to atu:Atu5002)

Predicted SEED Role

"Plasmid replication protein RepC" in subsystem Plasmid replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D451 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Atu5002 replication initiation protein RepC (Agrobacterium fabrum C58)
MEGGQVTTPFGRRPVTLALVKRQIATTKIEEGKSADKWRVFRDASEAREVLGLQDRSLAV
LDALLSFYPENELRQDAQLVVFPSNIQLSIRAHGIAGATLRRHLALLVEAGLIIRKDSAN
GKRYARKDDEGSIEHAFGFDISPLLMRAEELACLAQQVAADRIAFRRAKESLTICRRDIR
KLITAGVEEGASGDWSGLEERYLALVGQIPRNPTLNELSDLGAKMASLREDILKLLNSDD
FSSEMTTNDAQIERHIQNSNTNHLNELEPSSGNEQGAKPSQNKQAGHVPIKAFPIGLVLR
ACPEISNYGPEGQIGSWRELMTAAVVVRSMLGVSPSAYQEACEIMGPENAAVTIACILER
GGHINSPGGYLRDLTSKAKRGEFSLGPVLMALLRAGGHQVKATG