Protein Info for Atu4890 in Agrobacterium fabrum C58

Annotation: IS426 transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF13276: HTH_21" amino acids 34 to 84 (51 residues), 41.7 bits, see alignment 1.7e-14 PF00665: rve" amino acids 107 to 211 (105 residues), 64.2 bits, see alignment E=1.7e-21 PF13683: rve_3" amino acids 203 to 265 (63 residues), 50.4 bits, see alignment E=2.4e-17

Best Hits

Swiss-Prot: 48% identical to INSD1_ECOLI: Transposase InsD for insertion element IS2A (insD1) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4890)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHA6 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Atu4890 IS426 transposase (Agrobacterium fabrum C58)
MKAVADTLGVSRSNLIERLKGRSKPRGPYNKAEDAELLPAIRRLVDQRPTYGYRRIAALL
NRERRAADQPVVNAKRVHRIMGNHAMLLEHTAVRKGRLHDGKVMVMRSNLRWCSDGLEFA
CWNGEVIRLAFIIDAFDREIIAWTAVANAGISGSDVRDMMLEAVEKRFHATRAPHAIEHL
SDNGSAYTARDTRLFAQALNLTPCFTPVASPQSNGMSEAFVKTLKRDYIRISALPDAQTA
LRLIDGWIEDYNEIHPHSALKMASPRQFIRAKSI