Protein Info for Atu4870 in Agrobacterium fabrum C58

Annotation: NADP-dependent quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF08240: ADH_N" amino acids 27 to 85 (59 residues), 27.2 bits, see alignment E=4.5e-10 PF00107: ADH_zinc_N" amino acids 149 to 277 (129 residues), 103.7 bits, see alignment E=1.1e-33 PF13602: ADH_zinc_N_2" amino acids 181 to 316 (136 residues), 79 bits, see alignment E=1e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4870)

Predicted SEED Role

"FIG00732954: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH95 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Atu4870 NADP-dependent quinone oxidoreductase (Agrobacterium fabrum C58)
MKAAVYDQAGPPDVLTYRDVADPIVGPDDVLIAVEAISIEGGDLINRRSTPPPGRPWIVG
YAASGRVVGAGANVRDRKVGDRVTAFDMQGSHAELWAVPAIRTWLLPSGVDAASAAALPI
SFGTAHHCLFARGGLLRNQTVLVQAAAGGVGLAAVQLAAQAGATVIAVSSGESRLQRISS
LGADHVVDRSMGNVVEAVRQNTGGKGVDLVIDPVGVTLSASLTLLAPEGRLVFVGNAGGG
SLTIDLWPAMQSNQTLLGVFMGPLLERPQVRATVDEMLQMLDRREIRVMIEKTFPLSEAA
AAHDFAENAKPLGRVIMEP