Protein Info for Atu4858 in Agrobacterium fabrum C58

Annotation: virulence virD4-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 transmembrane" amino acids 21 to 37 (17 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details PF02534: T4SS-DNA_transf" amino acids 143 to 548 (406 residues), 277.8 bits, see alignment E=2.7e-86 PF10412: TrwB_AAD_bind" amino acids 229 to 535 (307 residues), 78.7 bits, see alignment E=6.2e-26 PF12696: TraG-D_C" amino acids 401 to 520 (120 residues), 98.4 bits, see alignment E=4.6e-32

Best Hits

KEGG orthology group: K03205, type IV secretion system protein VirD4 (inferred from 100% identity to atu:Atu4858)

Predicted SEED Role

"Type IV secretion system protein VirD4" in subsystem Type 4 secretion and conjugative transfer or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH86 at UniProt or InterPro

Protein Sequence (554 amino acids)

>Atu4858 virulence virD4-like protein (Agrobacterium fabrum C58)
MNRLRLSRDAFKNMMRAAARDPLWAFLALITMPFRIWKRLLGFMFILFNVNFVIGMGGGH
FLEQTGFERGSLVHIIPGLLTLLALAVISFWFITTPLILHFGDDDDDTHGSARFATDKEI
AALTSSGSGLLIGRDTKSAKPLRYDGPAHLLTMAPTRTGKGVGTIIPNLLTADRSVICVD
PKGENARITGRARQKFGPVHVLDPFGVTGRSSAAFNPLALLDPHSLDVADDANTLADALV
FDEPGMAGEAHWNEEAKALIAGLLLKIVADEPLSGRHLATLRDYLTLAPEQFAALLKRMQ
ESDAARGLVARAANRHLGKSDREAAGVLSAAQRHTHFLDSPRMTAVLSRSDFRFADLKRS
NVTVFLVLPPDRLSTYSRWLRLLVSQSLLEMARDPTKPATPVLYLLDEFASLGHLAPVER
AMGVMAGYGVQLWPILQDIHQLRATYGHRAGTFLSNAGVLQVFGVNDHDSARLISDLLGQ
ETVVFQTIARALYSDKTGITYSQQHTGRPLLTPDEVRNLPANGQLLFLAGQRPIFAEKLA
YFADPEFRQMFDPV