Protein Info for Atu4848 in Agrobacterium fabrum C58

Annotation: 2-deoxyribose-5-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF01791: DeoC" amino acids 53 to 267 (215 residues), 77 bits, see alignment E=8.8e-26 TIGR00126: deoxyribose-phosphate aldolase" amino acids 55 to 280 (226 residues), 151.5 bits, see alignment E=1.1e-48

Best Hits

Swiss-Prot: 63% identical to DEOC_HUMAN: Deoxyribose-phosphate aldolase (DERA) from Homo sapiens

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 100% identity to atu:Atu4848)

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.4

Use Curated BLAST to search for 4.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CW11 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Atu4848 2-deoxyribose-5-phosphate aldolase (Agrobacterium fabrum C58)
MSEAFPRNNGTALKPEWFDDVSVNRSASERRAATITTRRSVKKEYQVAWQIKAITCIDLT
TLSGDDTPGRVRRLCAKARRPVREDILETLGLADAGITTGAVCVYPTMVPHAVKALEGTA
IPVASVATGFPSGLTPLPQRLAEIRYAVEQGAKEIDIVITREFVLTQNWTALYDEISAMR
EACGDAHMKAILATGDLNTLTNVYRASMVAMQAGSDFIKTSTGKEEVNATLPVSLTMVRA
LRDYGELTGQMVGFKPAGGLKTAKDAVSWLTLMKEELGNRWLEPDLFRIGASSMLGDIER
QLEHFVTGRYSSAHHHAAA