Protein Info for Atu4817 in Agrobacterium fabrum C58

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 77 to 93 (17 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 16 to 194 (179 residues), 34.3 bits, see alignment E=5.1e-12 PF13579: Glyco_trans_4_4" amino acids 16 to 193 (178 residues), 37 bits, see alignment E=8.8e-13 PF00534: Glycos_transf_1" amino acids 213 to 379 (167 residues), 38.8 bits, see alignment E=1.4e-13 PF13692: Glyco_trans_1_4" amino acids 222 to 366 (145 residues), 36.8 bits, see alignment E=9.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4817)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CVY3 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Atu4817 glycosyltransferase (Agrobacterium fabrum C58)
MIFLNRYGFPDQSATSRMISSLAMSMAQRGMNVTVVTSREIHNHPGSVLPATETVRGIHI
QRLSSGRFGRHNLMRRSIDYLLFQVLAFAWLLRNVRATDTVIVCTDPPLLSVMSSIAIRL
KGALMVNWIMDLFPETAIELGFFRKRARWLAPWLTRARNWSLRSPGMVVCPTEKMAEFLF
TQGIAKDRVSVLHHWSDGEEIYPVLPEGNSLRKAWGLQDVFVVGYSGNFGRAHDFGTMLA
AAKRLEHRPDIRFLLIGGGHQHAAVKTVVQDLGLQNVIFKPLQPVENLAESLSVADVHLV
SLLPELEHCIIPSKFYGIMAAGRPTIFIGDPDGEVPRILRAKRCGSNVEIGETDKLTGII
EELCDDPDTTKAMGDAARRLLCTDYSREKAADAWAALIAGLQTVEPSRPHLAQGISP