Protein Info for Atu4790 in Agrobacterium fabrum C58

Annotation: GDP-fucose synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF04321: RmlD_sub_bind" amino acids 9 to 103 (95 residues), 32.6 bits, see alignment E=6.7e-12 PF01370: Epimerase" amino acids 11 to 240 (230 residues), 206.5 bits, see alignment E=6.3e-65 PF16363: GDP_Man_Dehyd" amino acids 42 to 300 (259 residues), 55.2 bits, see alignment E=1.2e-18

Best Hits

Swiss-Prot: 56% identical to FCL_SINFN: GDP-L-fucose synthase (fcl) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 100% identity to atu:Atu4790)

MetaCyc: 56% identical to GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase (Arabidopsis thaliana col)
GDP-L-fucose synthase. [EC: 1.1.1.271]

Predicted SEED Role

"GDP-L-fucose synthetase (EC 1.1.1.271)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 1.1.1.271)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.271

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH50 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Atu4790 GDP-fucose synthetase (Agrobacterium fabrum C58)
MPFSLNGKRVWVAGHTGMVGSALVRRLERENCEILKVSRRELDLTRQYETEQWMAAARPQ
VIFVAAAKVGGIAANAAYPADFLYTNTLISMNIMKSAADIGVEKLLWMGSSCIYPKFAAQ
PITENALLTGPLEPTNEAYAIAKIAALKLSQFYSIQYGLNCVSVMPTNIYGLNDNFDPQS
SHVIPAMIRRMHEAKISGQNKIVLWGTGSPLREFLHVDDLADACCFLMKSSAHFPLINIG
SGREISIRNLAHLIAGIVGYEGQIVFDTSKPDGAPRKLLDCSRLNALGWNSTVELRYGIQ
DLYEWWRHPKSLQSDMLRQAAR