Protein Info for Atu4783 in Agrobacterium fabrum C58

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13531: SBP_bac_11" amino acids 30 to 288 (259 residues), 72.3 bits, see alignment E=1e-23 PF13416: SBP_bac_8" amino acids 43 to 302 (260 residues), 86.4 bits, see alignment E=5.9e-28 PF01547: SBP_bac_1" amino acids 47 to 282 (236 residues), 59.5 bits, see alignment E=1.2e-19 PF13343: SBP_bac_6" amino acids 85 to 318 (234 residues), 107 bits, see alignment E=2.2e-34

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 100% identity to atu:Atu4783)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CH49 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Atu4783 ABC transporter substrate-binding protein (Agrobacterium fabrum C58)
MKASLAAFSAGLALWAFGTAGAQADGRLNILCAADDAWCAAMQRAYETKTGVQTIMVRKS
TGEILEQVRKEKDAPTVDVWWAGTGDTHLQAASEGLLEAYASKNETEVLPWAQNFFTMSG
GQSAGIYAGALGFAYNSDLLQRQGLPVPSCWKDLISETYRGKILAGNPNSSGTAFTMLAT
LVQLFGEEEAFSYMKALDQNVAEYTKAGSAPVKAAARGEAVIGISFMHDAVTQKEAGAPL
VIVAPCEGTGYEIGAVSIVRGTKNREEARRFVDFALSPDGQATGAAAGQNQVPSNAKAAL
PAGAPDLSLIKMVDYDFATFGTPEERGRLLRRFDTEVHPPSQ